Edit |   |
Antigenic Specificity | FN3K |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human (antigen sequence identity: mouse 92%, rat 60%) |
Isotype | n/a |
Format | antigen affinity purified |
Size | 100 µl |
Concentration | n/a |
Applications | IHC. Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-human FN3K polyclonal antibody. |
Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: EVASLEALRSTGLVRVPRPMKVIDLPGGGAAFVMEHLKMKSLSSQASKLGEQM |
Other Names | fructosamine 3 kinase |
Gene, Accession # | Gene ID: 64122, UniProt: Q9H479, ENSG00000167363 |
Catalog # | HPA061358 |
Price | |
Order / More Info | FN3K Antibody from ATLAS ANTIBODIES AB |
Product Specific References | n/a |