Edit |   |
Antigenic Specificity | PDCL3 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human (antigen sequence identity: mouse 84%, rat 84%) |
Isotype | n/a |
Format | antigen affinity purified |
Size | 100 µl |
Concentration | n/a |
Applications | ICC-IF, IHC, WB. Recombinant expression validation in WB using target protein overexpression. |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-human PDCL3 polyclonal antibody. |
Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: IGPLVFGGMNLTRDELEWKLSESGAIMTDLEENPKKPIEDVLLSSVRRSVLMKRDSDSEGD |
Other Names | phosducin-like 3, VIAF1 |
Gene, Accession # | Gene ID: 79031, UniProt: Q9H2J4, ENSG00000115539 |
Catalog # | HPA018469 |
Price | |
Order / More Info | PDCL3 Antibody from ATLAS ANTIBODIES AB |
Product Specific References | n/a |