Edit |   |
Antigenic Specificity | POLR2I |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human (antigen sequence identity: mouse 100%, rat 100%) |
Isotype | n/a |
Format | antigen affinity purified |
Size | 100 µl |
Concentration | n/a |
Applications | ICC-IF |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-human POLR2I polyclonal antibody. |
Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: DELTQIIADVSQDPTLPRTEDHPCQKCGHKEAVFFQSHSARAEDAMRLYYVCT |
Other Names | polymerase (RNA) II (DNA directed) polypeptide I, 14.5kDa, hRPB14.5, RPB9 |
Gene, Accession # | Gene ID: 5438, UniProt: P36954, ENSG00000105258 |
Catalog # | HPA035632 |
Price | |
Order / More Info | POLR2I Antibody from ATLAS ANTIBODIES AB |
Product Specific References | n/a |