Edit |   |
Antigenic Specificity | GDPD3 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human (antigen sequence identity: mouse 87%, rat 85%) |
Isotype | n/a |
Format | antigen affinity purified |
Size | 100 µl |
Concentration | n/a |
Applications | ICC-IF, IHC, WB |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-human GDPD3 polyclonal antibody. |
Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: LRRPHLLHTPRAPTFRIRLGAHRGGSGELLENTMEAMENSMAQRSDLLELDCQLTRDRVVVV |
Other Names | glycerophosphodiester phosphodiesterase domain containing 3, MGC4171 |
Gene, Accession # | Gene ID: 79153, UniProt: Q7L5L3, ENSG00000102886 |
Catalog # | HPA041470 |
Price | |
Order / More Info | GDPD3 Antibody from ATLAS ANTIBODIES AB |
Product Specific References | n/a |