Edit |   |
Antigenic Specificity | PNMA6A |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human (antigen sequence identity: mouse 55%, rat 49%) |
Isotype | n/a |
Format | antigen affinity purified |
Size | 100 µl |
Concentration | n/a |
Applications | IHC |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-human PNMA6A polyclonal antibody. |
Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: IPEDCDDAEFQESLEAALRPMGHFTVLGKAFREEDNATAALVELDREVN |
Other Names | paraneoplastic Ma antigen family member 6A, MGC15827, PNMA6C |
Gene, Accession # | Gene ID: 84968, UniProt: P0CW24, ENSG00000235961 |
Catalog # | HPA052115 |
Price | |
Order / More Info | PNMA6A Antibody from ATLAS ANTIBODIES AB |
Product Specific References | n/a |