Edit |   |
Antigenic Specificity | SPINK9 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human (antigen sequence identity: mouse 38%, rat 38%) |
Isotype | n/a |
Format | antigen affinity purified |
Size | 100 µl |
Concentration | n/a |
Applications | IHC |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-human SPINK9 polyclonal antibody. |
Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: KQMVDCSHYKKLPPGQQRFCHHMYDPICGSDGKTYKNDCFFCSKVKKTDGTLKFVH |
Other Names | serine peptidase inhibitor, Kazal type 9 |
Gene, Accession # | Gene ID: 643394, UniProt: Q5DT21, ENSG00000204909 |
Catalog # | HPA038288 |
Price | |
Order / More Info | SPINK9 Antibody from ATLAS ANTIBODIES AB |
Product Specific References | n/a |