| 产品详情 |
| Edit |   |
| Antigenic Specificity | Endophilin A1/SH3GL2 |
| Clone | 5A6 |
| Host Species | Mouse |
| Reactive Species | human, rat |
| Isotype | IgG2a kappa |
| Format | IgG purified, no preservative |
| Size | 0.1 mg |
| Concentration | n/a |
| Applications | Western Blot, ELISA, Immunohistochemistry-Paraffin. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Endophilin A1/SH3GL2 Antibody (5A6) from Novus Biologicals is a mouse monoclonal antibody to Endophilin A1/SH3GL2. This antibody reacts with human, rat. The Endophilin A1/SH3GL2 Antibody (5A6) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry-Paraffin. |
| Immunogen | SH3GL2 (NP_003017 64 a.a. - 124 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SRAKLSMINTMSKIRGQEKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMREL |
| Other Names | CNSA2FLJ25015, EEN-B1bA335L15.1 (SH3-domain GRB2-like 2), Endophilin-1, endophilin-A1, FLJ20276, SH3 domain protein 2A, SH3 domain-containing GRB2-like protein 2, SH3D2AEndophilin A1 BAR domain, SH3-domain GRB2-like 2, SH3P4endophilin-1 |
| Gene, Accession # | SH3GL2, Gene ID: 6456, Accession: NP_003017, SwissProt: NP_003017 |
| Catalog # | H00006456-M01 |
| Price | |
| Order / More Info | Endophilin A1/SH3GL2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 19498008, 22968441 |
| 产品资料 |
|
|