| Edit |   |
|---|
| Antigenic Specificity | GTF2IRD2B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GTF2IRD2B Antibody from Novus Biologicals is a rabbit polyclonal antibody to GTF2IRD2B. This antibody reacts with human. The GTF2IRD2B Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human GTF2IRD2B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DSFMSSRGKPLPQLSSIDWIRDLAFLVDMTMHLNALNISLQGHSQIVTQMYDLIRAFLAKLCLWETHLTRNNLAHF |
|---|
| Other Names | GTF2I Repeat Domain Containing 2B, GTF2I Repeat Domain-Containing Protein 2B, Transcription Factor GTF2IRD2-Beta |
|---|
| Gene, Accession # | GTF2IRD2B, Gene ID: 389524 |
|---|
| Catalog # | NBP2-55294 |
|---|
| Price | |
|---|
| Order / More Info | GTF2IRD2B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|