| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Fas/TNFRSF6/CD95 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Fas/TNFRSF6/CD95 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Fas/TNFRSF6/CD95. This antibody reacts with human. The Fas/TNFRSF6/CD95 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Fas/TNFRSF6/CD95 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAH |
|---|
| Other Names | Apo-1 antigen, apoptosis antigen 1, Apoptosis-mediating surface antigen FAS, APT1FASTM, CD95 antigen, CD95ALPS1A, Fas (TNF receptor superfamily, member 6), Fas AMA, Fas antigen, FAS1, FASLG receptor, TNFRSF6member 6, tumor necrosis factor receptor superfamily member 6 |
|---|
| Gene, Accession # | FAS, Gene ID: 355 |
|---|
| Catalog # | NBP1-89034 |
|---|
| Price | |
|---|
| Order / More Info | Fas/TNFRSF6/CD95 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 29747634 |
|---|
| 产品资料 |
|
|