Edit |   |
Antigenic Specificity | KLHL9 |
Clone | polyclonal |
Host Species | Rabbit |
Reactive Species | human (antigen sequence identity: mouse 100%, rat 100%) |
Isotype | n/a |
Format | antigen affinity purified |
Size | 100 µl |
Concentration | n/a |
Applications | ICC-IF |
Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
Description | Rabbit anti-human KLHL9 polyclonal antibody. |
Immunogen | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: QSDVGVAVFENKIYVVGGYSWNNRCMVEIVQKYDPEKDEWHKVFDLPESLGGIRACTLTV |
Other Names | kelch-like family member 9, FLJ13568, KIAA1354 |
Gene, Accession # | Gene ID: 55958, UniProt: Q9P2J3, ENSG00000198642 |
Catalog # | HPA059901 |
Price | |
Order / More Info | KLHL9 Antibody from ATLAS ANTIBODIES AB |
Product Specific References | n/a |