| Edit |   |
|---|
| Antigenic Specificity | Flt-3 Ligand |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 20 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Flt-3 Ligand Antibody from Novus Biologicals is a rabbit polyclonal antibody to Flt-3 Ligand. This antibody reacts with human. The Flt-3 Ligand Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to FLT3LG(fms-related tyrosine kinase 3 ligand) The peptide sequence was selected form the N terminal of FLT3LG. Peptide sequence TVLAPAWSPTTYLLLLLLLSSGLSGTQDCSFQHSPISSDFAVKIRELSDY. |
|---|
| Other Names | FL, Flt3 ligand, FLT3L, fms-related tyrosine kinase 3 ligand, SL cytokine |
|---|
| Gene, Accession # | FLT3LG, Gene ID: 2323, Accession: P49771, SwissProt: P49771 |
|---|
| Catalog # | NBP1-62304-20ul |
|---|
| Price | |
|---|
| Order / More Info | Flt-3 Ligand Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|