| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DPP3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DPP3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DPP3. This antibody reacts with human. The DPP3 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human DPP3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EGLVTITPTTGSDGRPDARVRLDRSKIRSVGKPALERFLRRLQVLKSTGDVAGGRALYEGYATVTDAPPECFLTLRDTVLLRKESRKLIVQPNTR |
|---|
| Other Names | Dipeptidyl aminopeptidase III, Dipeptidyl arylamidase III, dipeptidyl peptidase 3, Dipeptidyl peptidase III, dipeptidylpeptidase 3, dipeptidyl-peptidase 3, dipeptidylpeptidase III, DPP III, DPPIII, EC 3.4.14.4, FLJ11387, FLJ22331 |
|---|
| Gene, Accession # | DPP3, Gene ID: 10072, Accession: Q9NY33, SwissProt: Q9NY33 |
|---|
| Catalog # | NBP2-34021 |
|---|
| Price | |
|---|
| Order / More Info | DPP3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|