| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | DPP6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The DPP6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DPP6. This antibody reacts with human, mouse. The DPP6 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human, mouse DPP6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: VKKAINDRQMPKVEYRDIEIDDYNLPMQILKPATFTDTTHYPLLLVVDGTPGSQSVAEKFEVSWETVMVSSHGAVVVKCDG |
|---|
| Other Names | dipeptidyl aminopeptidase IV-related protein, dipeptidyl aminopeptidase-like protein 6, Dipeptidyl aminopeptidase-related protein, Dipeptidyl peptidase 6, Dipeptidyl peptidase IV-like protein, dipeptidyl peptidase IV-related protein, Dipeptidyl peptidase VI, dipeptidylpeptidase 6, dipeptidyl-peptidase 6, dipeptidylpeptidase VI, DPP VI, DPPXFLJ55680, MGC46605, VF2 |
|---|
| Gene, Accession # | DPP6, Gene ID: 1804 |
|---|
| Catalog # | NBP2-47481 |
|---|
| Price | |
|---|
| Order / More Info | DPP6 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|