| Edit |   |
| Antigenic Specificity | C16orf93 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, porcine, rat, guinea pig, dog, horse |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-C16orf93 Antibody |
| Immunogen | The immunogen for Anti-C16orf93 Antibody is: synthetic peptide directed towards the C-terminal region of Human C16orf93. Synthetic peptide located within the following region: ETVAPPEPEPSHIHVLRAYIKTQVNKELEQLQGLVEERLKASEERLSSKL |
| Other Names | chromosome 16 open reading frame 93 |
| Gene, Accession # | C16orf93, Accession: NM_001014979 |
| Catalog # | TA334141 |
| Price | |
| Order / More Info | C16orf93 Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |