| 产品详情 |
| Edit |   |
| Antigenic Specificity | 4EBP1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The 4EBP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to 4EBP1. This antibody reacts with human, mouse, rat. The 4EBP1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat 4EBP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI |
| Other Names | 4E-BP1, eIF4E-binding protein 1, eukaryotic translation initiation factor 4E binding protein 1,4EBP1,4E-BP1BP-1, eukaryotic translation initiation factor 4E-binding protein 1, PHAS-IMGC4316, Phosphorylated heat- and acid-stable protein regulated by insulin 1 |
| Gene, Accession # | EIF4EBP1, Gene ID: 1978 |
| Catalog # | NBP1-89368 |
| Price | |
| Order / More Info | 4EBP1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|