| 产品详情 |
| Edit |   |
| Antigenic Specificity | KCNJ15 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. IHC reported in scientific literature (PMID: 29137350). For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The KCNJ15 Antibody from Novus Biologicals is a rabbit polyclonal antibody to KCNJ15. This antibody reacts with human. The KCNJ15 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human KCNJ15 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SAVCQSRTSYIPEEIYWGFEFVPVVSLSKNGKYVADFSQFEQIRKSPDCTFYCADSEKQQLEEKYRQEDQRERELRTL |
| Other Names | inward rectifier K+ channel KIR4.2, inwardly rectifing potassium channel Kir4.210ATP-sensitive inward rectifier potassium channel 15, inwardly rectifying subfamily J member 15, KCNJ14, Kir1.3, Kir4.2, MGC13584, potassium inwardly-rectifying channel, subfamily J, member 15 |
| Gene, Accession # | KCNJ15, Gene ID: 3772 |
| Catalog # | NBP1-83091 |
| Price | |
| Order / More Info | KCNJ15 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 21719736, 29137350 |
| 产品资料 |
|
|