| Edit |   |
| Antigenic Specificity | FAM153B |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 50ug |
| Concentration | n/a |
| Applications | WB |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | Rabbit Polyclonal Anti-FAM153B Antibody |
| Immunogen | The immunogen for Anti-FAM153B Antibody is: synthetic peptide directed towards the C-terminal region of Human FAM153B. Synthetic peptide located within the following region: DPATLAKQLEDSTITGSHQQMSASPSSAPAEEATEKTKVEEEVKTRKPKK |
| Other Names | family with sequence similarity 153, memberB |
| Gene, Accession # | F153B, Accession: NM_001079529 |
| Catalog # | TA335932 |
| Price | |
| Order / More Info | FAM153B Antibody from ORIGENE TECHNOLOGIES |
| Product Specific References | n/a |