| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | BCS1L |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The BCS1L Antibody from Novus Biologicals is a rabbit polyclonal antibody to BCS1L. This antibody reacts with human. The BCS1L Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human BCS1L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LEHSICLLSLTDSSLSDDRLNHLLSVAPQQSLVLLEDVDAAFLSRDLAVENPVKYQGLGRLTFSGLLNALDGVASTEARIVFMTTNH |
|---|
| Other Names | BCS, BCS1, BCS1 (yeast homolog)-like, BCS1-like (S. cerevisiae), BCS1-like (yeast), BCS1-like protein, BJSGRACILE, FLNMS, h-BCS, h-BCS1, mitochondrial chaperone BCS1, mitochondrial complex III assembly, PTD |
|---|
| Gene, Accession # | BCS1L, Gene ID: 617 |
|---|
| Catalog # | NBP1-88677 |
|---|
| Price | |
|---|
| Order / More Info | BCS1L Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|