| 产品详情 |
| Edit |   |
| Antigenic Specificity | BDH2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The BDH2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to BDH2. This antibody reacts with human. The BDH2 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human BDH2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: CPGTVDTPSLQERIQARGNPEEARNDFLKRQKTGRFATAEEIAMLCVYLASDESAYVTGNPVIIDGGWSL |
| Other Names | 3-hydroxybutyrate dehydrogenase, type 2, dehydrogenase/reductase (SDR family) member 6, Dehydrogenase/reductase SDR family member 6, DHRS6, EC 1.1.1.-, EC 1.1.1.30, EFA6R, FLJ13261, Oxidoreductase UCPA, PRO20933, R-beta-hydroxybutyrate dehydrogenase, SDR15C1,3-hydroxybutyrate dehydrogenase type 2, short chain dehydrogenase/reductase family 15C, member 1, UCPA-OR, UNQ6308 |
| Gene, Accession # | BDH2, Gene ID: 56898 |
| Catalog # | NBP1-85218 |
| Price | |
| Order / More Info | BDH2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|