| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | EID2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The EID2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to EID2. This antibody reacts with human. The EID2 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human EID2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: AREAAFDAEYQRNPHRVDLDILTFTIALTASEVINPLIEELGCDKFINRE |
|---|
| Other Names | CREBBP/EP300 inhibitor 2E1A like inhibitor of differentiation 2, CREBBP/EP300 inhibitory protein 2, CRI2EP300-interacting inhibitor of differentiation 2, EID-2EID-1-like inhibitor of differentiation 2, EP300 interacting inhibitor of differentiation 2, MGC20452 |
|---|
| Gene, Accession # | EID2, Gene ID: 163126 |
|---|
| Catalog # | NBP1-94096 |
|---|
| Price | |
|---|
| Order / More Info | EID2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|