| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | EID2B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The EID2B Antibody from Novus Biologicals is a rabbit polyclonal antibody to EID2B. This antibody reacts with human. The EID2B Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human EID2B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: QQLAFLEINRQLLFREYLDGSSMIPVRLLRDFEERRRLFVEGCKA |
|---|
| Other Names | EID-2B, EID-2-like inhibitor of differentiation 3, EID3, EID-3EID-2-like inhibitor of differentiation-3, EP300 interacting inhibitor of differentiation 2B, EP300-interacting inhibitor of differentiation 2B, FLJ38944 |
|---|
| Gene, Accession # | EID2B, Gene ID: 126272, Accession: Q96D98, SwissProt: Q96D98 |
|---|
| Catalog # | NBP2-38048 |
|---|
| Price | |
|---|
| Order / More Info | EID2B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|