| 产品详情 |
| Edit |   |
| Antigenic Specificity | EIF3A |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The EIF3A Antibody from Novus Biologicals is a rabbit polyclonal antibody to EIF3A. This antibody reacts with human, mouse, rat. The EIF3A Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat EIF3A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LQNNTILRLLQQVSQIYQSIEFSRLTSLVPFVDAFQLERAIVDAARHCDLQVRIDHTSRTLSFGSDLNYATREDAPIG |
| Other Names | centrosomin homolog, cytoplasmic protein p167, eIF3 p167, eIF3 p180, eIF3 p185, EIF3, p180 subunit, eIF3a, eIF3-p170, EIF3S10EIF3, eIF-3-theta, eIF3-theta, Eukaryotic translation initiation factor 3 subunit 10, eukaryotic translation initiation factor 3 subunit A, eukaryotic translation initiation factor 3, subunit 10 (theta, 150/170kD), eukaryotic translation initiation factor 3, subunit 10 (theta, 170kD), eukaryotic translation initiation factor 3, subunit 10 theta, 150/170kDa, eukaryotic translation initiation factor 3, subunit 10, 170kD, eukaryotic translation initiation factor 3, subunit A, KIAA0139P167, p180, p185, TIF32 |
| Gene, Accession # | EIF3A, Gene ID: 8661 |
| Catalog # | NBP1-84876 |
| Price | |
| Order / More Info | EIF3A Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|