| 产品详情 |
| Edit |   |
| Antigenic Specificity | EPS8L2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The EPS8L2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to EPS8L2. This antibody reacts with human, rat. The EPS8L2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, rat EPS8L2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SVSCPLLSRDAVDFLRGHLVPKEMSLWESLGESWMRPRSEWPREPQVPLYVPKFHSGWEPPVDVLQEAPWEVEGLASAPIEEVSPVSR |
| Other Names | epidermal growth factor receptor kinase substrate 8-like protein 2, Epidermal growth factor receptor pathway substrate 8-related protein 2, EPS8-like 2, EPS8-like protein 2, EPS8R2, EPS8-related protein 2, FLJ16738, FLJ21935, FLJ22171, MGC126530, MGC3088 |
| Gene, Accession # | EPS8L2, Gene ID: 64787 |
| Catalog # | NBP1-83613 |
| Price | |
| Order / More Info | EPS8L2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|