| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NHLH2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NHLH2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NHLH2. This antibody reacts with human. The NHLH2 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human NHLH2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LSPDQAADSDHPSSAHSDPESLGGTDTKVLGSVSDLEPVEEAEGDGKGGSRAALYPHPQQLSREE |
|---|
| Other Names | BHLHA34, bHLHa34NSCL-2, Class A basic helix-loop-helix protein 34, helix-loop-helix protein 2, HEN-2, HEN2NSCL2, nescient helix loop helix 2KIAA0490 |
|---|
| Gene, Accession # | NHLH2, Gene ID: 4808, Accession: Q02577, SwissProt: Q02577 |
|---|
| Catalog # | NBP2-30642 |
|---|
| Price | |
|---|
| Order / More Info | NHLH2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|