| Edit |   |
| Antigenic Specificity | UBTD2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The UBTD2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to UBTD2. This antibody reacts with human. The UBTD2 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the C terminal of human UBTD2The immunogen for this antibody is UBTD2. Peptide sequence TDTVFHMKRRLHAAEGVEPGSQRWFFSGRPLTDKMKFEELKIPKDYVVQV. |
| Other Names | DC-UbP, DCUBPDendritic cell-derived ubiquitin-like protein, MGC30022ubiquitin domain-containing protein 2, ubiquitin domain containing 2, Ubiquitin-like protein SB72 |
| Gene, Accession # | UBTD2, Gene ID: 92181, Accession: NP_689490, SwissProt: NP_689490 |
| Catalog # | NBP1-79759-20ul |
| Price | |
| Order / More Info | UBTD2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |