| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | UBXD5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The UBXD5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to UBXD5. This antibody reacts with human. The UBXD5 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human UBXD5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SENGEQAFLLMMQPDNTIGDVRALLAQARVMDASAFEIFSTFPPTLYQDDTLTLQAAGLVPKAALLLRARRAPKSSLKFSPGP |
|---|
| Other Names | COA-1, Colorectal tumor-associated antigen COA-1, colorectal tumor-associated antigen-1, SOCDKFZp686F04228, SOCI, socius, UBX domain containing 5, UBX domain protein 11, UBX domain-containing protein 11, UBX domain-containing protein 5, UBXD5 |
|---|
| Gene, Accession # | UBXN11, Gene ID: 91544 |
|---|
| Catalog # | NBP1-87018 |
|---|
| Price | |
|---|
| Order / More Info | UBXD5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|