| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | UBXN10 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. WB, ICC/IF reported in scientific literature (PMID: 26389662). For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The UBXN10 Antibody from Novus Biologicals is a rabbit polyclonal antibody to UBXN10. This antibody reacts with human. The UBXN10 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human UBXN10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RFVRHFRPTDDLQTIVAVAEQKNKTSYRHCSIETMEVPRRRFSDLTKSLQECRIPHKSVLGISLEDGEGW |
|---|
| Other Names | FLJ25429, UBX domain containing 3, UBX domain protein 10, UBX domain-containing protein 10, UBX domain-containing protein 3, UBXD3 |
|---|
| Gene, Accession # | UBXN10, Gene ID: 127733 |
|---|
| Catalog # | NBP1-83561 |
|---|
| Price | |
|---|
| Order / More Info | UBXN10 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 26389662 |
|---|
| 产品资料 |
|
|