| Edit |   |
| Antigenic Specificity | Cyclin D2 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100. IHC-P reactivity reported in (PMID: 27583477). ICC/IF reported in verified customer review. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Cyclin D2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Cyclin D2. This antibody reacts with human. The Cyclin D2 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human Cyclin D2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QEQIEAVLLNSLQQYRQDQRDGSKSEDELDQASTPTDVRGIDL |
| Other Names | cyclin D2, G1/S-specific cyclin D2, G1/S-specific cyclin-D2, KIAK0002, MGC102758 |
| Gene, Accession # | CCND2, Gene ID: 894 |
| Catalog # | NBP2-14460 |
| Price | |
| Order / More Info | Cyclin D2 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 23227862, 27583477 |