| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PPIL4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PPIL4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PPIL4. This antibody reacts with human. The PPIL4 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human PPIL4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SSHSHTSKKHKKKTHHCSEEKEDEDYMPIKNTNQDIYREMGFGHYEEEESCWEKQKSEKRDRTQNRSRS |
|---|
| Other Names | Cyclophilin-like protein PPIL4, cyclophilin-type peptidyl-prolyl cis-trans isomerase, EC 5.2.1.8, HDCME13P, peptidyl-prolyl cis-trans isomerase-like 4, peptidylprolyl isomerase (cyclophilin)-like 4, PPIase, Rotamase PPIL4, serologically defined breast cancer antigen NY-BR-18 |
|---|
| Gene, Accession # | PPIL4, Gene ID: 85313 |
|---|
| Catalog # | NBP2-55080 |
|---|
| Price | |
|---|
| Order / More Info | PPIL4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|