| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | PPIL5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The PPIL5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PPIL5. This antibody reacts with human. The PPIL5 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human PPIL5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GSHIIPFHLCQDLDTAKICVCGRFCLNSFIQGTTTMNLHSVAHTVVLVDNLGGTEAPIISYFCSLGCYVNSSDM |
|---|
| Other Names | 4-1BBlrr, cyclophilin-like 5,4-1BB-mediated-signaling molecule, leucine rich repeat protein 1, LRR-1LRR-repeat protein 1, MGC20689,4-1BBLRR, peptidylprolyl isomerase (cyclophilin)-like 5,4-1BB-mediated signaling molecule, Peptidylprolyl isomerase-like 5, PPIL5 |
|---|
| Gene, Accession # | LRR1, Gene ID: 122769 |
|---|
| Catalog # | NBP2-49457 |
|---|
| Price | |
|---|
| Order / More Info | PPIL5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|