| Edit |   |
| Antigenic Specificity | HIPK4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The HIPK4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to HIPK4. This antibody reacts with human. The HIPK4 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to HIPK4(homeodomain interacting protein kinase 4) The peptide sequence was selected from the middle region of HIPK4. Peptide sequence AEEKEAAGMGSVAGSSPFFREEKAPGMQRAIDQLDDLSLQEAGHGLWGET. |
| Other Names | EC 2.7.11.1, FLJ32818, homeodomain interacting protein kinase 4, homeodomain-interacting protein kinase 4 |
| Gene, Accession # | HIPK4, Gene ID: 147746, Accession: Q8NE63, SwissProt: Q8NE63 |
| Catalog # | NBP1-56326 |
| Price | |
| Order / More Info | HIPK4 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |