| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | COL4A6 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The COL4A6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to COL4A6. This antibody reacts with human. The COL4A6 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human COL4A6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: EPILSTIQGMPGDRGDSGSQGFRGVIGEPGKDGV |
|---|
| Other Names | collagen alpha 6 type IV, collagen alpha-6(IV) chain, collagen IV, alpha-6 polypeptide, collagen of basement membrane, alpha-6, collagen, type IV, alpha 6, CXDELq22.3, DELXq22.3, dJ889N15.4 (Collagen Alpha 6(IV)), EC 2.7.7.8, MGC88184 |
|---|
| Gene, Accession # | COL4A6, Gene ID: 1288 |
|---|
| Catalog # | NBP2-56903 |
|---|
| Price | |
|---|
| Order / More Info | COL4A6 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|