| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | COL4A3BP |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The COL4A3BP Antibody from Novus Biologicals is a rabbit polyclonal antibody to COL4A3BP. This antibody reacts with human. The COL4A3BP Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human COL4A3BP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SGASGYSATSTSSFKKGHSLREKLAEMETFRDILCRQVDTLQKYFDACADAVSKDELQRDKVVEDDEDDFPTTRSDGDFLH |
|---|
| Other Names | Ceramide transfer protein, CERTFLJ20597, CERTL, collagen type IV alpha-3-binding protein, collagen, type IV, alpha 3 (Goodpasture antigen) binding protein, Goodpasture antigen-binding protein, GPBPSTARD11ceramide transporter, hCERT, lipid-transfer protein CERTL, StARD11, StAR-related lipid transfer (START) domain containing 11, StAR-related lipid transfer protein 11, START domain containing 11, START domain-containing protein 11 |
|---|
| Gene, Accession # | COL4A3BP, Gene ID: 10087 |
|---|
| Catalog # | NBP2-59018 |
|---|
| Price | |
|---|
| Order / More Info | COL4A3BP Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|