| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MOBKL3 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MOBKL3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MOBKL3. This antibody reacts with human. The MOBKL3 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat MOBKL3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RQFCLELNGLAVKLQSECHPDTCTQMTATEQWIFLCAAHKTPKECPAIDY TRHTLDGAACLLNSNKYFPSRVSIKES |
|---|
| Other Names | 2C4D, CGI-95, Class II mMOB1, MOB1, MOB1, Mps One Binder kinase activator-like 3 (yeast), MOB1DKFZP564M112, Mob3, MOB3MGC12264, MOB4 MOB family member 4, phocein, MOBKL3, phocein, PHOCN, PREI3, PREI3mps one binder kinase activator-like 3, Preimplantation protein 3Mob1 homolog 3,2C4DCGI-95 |
|---|
| Gene, Accession # | MOB4, Gene ID: 25843 |
|---|
| Catalog # | NBP2-14535 |
|---|
| Price | |
|---|
| Order / More Info | MOBKL3 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|