| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MOBKL1B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MOBKL1B Antibody from Novus Biologicals is a rabbit polyclonal antibody to MOBKL1B. This antibody reacts with human. The MOBKL1B Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human MOBKL1B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNL |
|---|
| Other Names | C2orf6, chromosome 2 open reading frame 6, FLJ10788, FLJ11595, MATS1, MOB1, Mob1 alpha, Mob1 homolog 1B, MOB1, Mps One Binder kinase activator-like 1B (yeast), mob1A, Mob4B, MOBK1B, mps one binder kinase activator-like 1B, Protein Mob4B |
|---|
| Gene, Accession # | MOB1A, Gene ID: 55233 |
|---|
| Catalog # | NBP2-57643 |
|---|
| Price | |
|---|
| Order / More Info | MOBKL1B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|