| Edit |   |
|---|
| Antigenic Specificity | MOBP |
|---|
| Clone | 4C2 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. It has been used for ELISA and WB. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MOBP Antibody (4C2) from Novus Biologicals is a mouse monoclonal antibody to MOBP. This antibody reacts with human. The MOBP Antibody (4C2) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | MOBP (AAH22471, 1 a.a. - 81 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSQKPAKEGPRLSKNQKYSEHFSIHCCPPFTFLNSKKEIVDRKYSICKSGCFYQKKEEDWICCACQKTRLKRKIRPTPKKK |
|---|
| Other Names | MGC87379, myelin-associated oligodendrocyte basic protein |
|---|
| Gene, Accession # | MOBP, Gene ID: 4336, Accession: AAH22471, SwissProt: AAH22471 |
|---|
| Catalog # | H00004336-M08 |
|---|
| Price | |
|---|
| Order / More Info | MOBP Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|