| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MOCS2 |
|---|
| Clone | 4H3 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. It has been used for ELISA and WB. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MOCS2 Antibody (4H3) from Novus Biologicals is a mouse monoclonal antibody to MOCS2. This antibody reacts with human. The MOCS2 Antibody (4H3) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | MOCS2 (NP_789776.1, 1 a.a. - 88 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MVPLCQVEVLYFAKSAEITGVRSETISVPQEIKALQLWKEIETRHPGLADVRNQIIFAVRQEYVELGDQLLVLQPGDEIAVIPPISGG |
|---|
| Other Names | EC 2.-, MCBPE, MOCO1-A, MOCO1-B, MOCO1MOCS2B, MOCS2A, molybdenum cofactor biosynthesis protein E, molybdenum cofactor synthesis 2, Molybdenum cofactor synthesis protein 2 large subunit, Molybdenum cofactor synthesis protein 2 small subunit, Molybdenum cofactor synthesis protein 2A, Molybdenum cofactor synthesis protein 2B, molybdopterin synthase catalytic subunit, molybdopterin synthase sulfur carrier subunit, Molybdopterin-synthase large subunit, Molybdopterin-synthase small subunit, MPT synthase large subunit, MPTS, Sulfur carrier protein MOCS2A |
|---|
| Gene, Accession # | MOCS2, Gene ID: 4338, Accession: NP_789776.1, SwissProt: NP_789776.1 |
|---|
| Catalog # | H00004338-M05 |
|---|
| Price | |
|---|
| Order / More Info | MOCS2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|