| Edit |   |
| Antigenic Specificity | Tropomodulin 3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Tropomodulin 3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Tropomodulin 3. This antibody reacts with human. The Tropomodulin 3 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to TMOD3(tropomodulin 3 (ubiquitous)) The peptide sequence was selected from the middle region of TMOD3. Peptide sequence ITNTKFCNIMGSSNGVDQEHFSNVVKGEKILPVFDEPPNPTNVEESLKRT. |
| Other Names | tropomodulin 3 (ubiquitous), tropomodulin-3, Ubiquitous tropomodulin, U-Tmod, UTMOD |
| Gene, Accession # | TMOD3, Gene ID: 29766, Accession: Q9NYL9, SwissProt: Q9NYL9 |
| Catalog # | NBP1-56652 |
| Price | |
| Order / More Info | Tropomodulin 3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |