| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Tropomyosin-1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Tropomyosin-1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Tropomyosin-1. This antibody reacts with human. The Tropomyosin-1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to TPM1(tropomyosin 1 (alpha)) The peptide sequence was selected from the middle region of TPM1. Peptide sequence LKEAETRAEFAERSVTKLEKSIDDLEDQLYQQLEQNRRLTNELKLALNED. |
|---|
| Other Names | alpha tropomyosin, alpha-tropomyosin, C15orf13, cardiomyopathy, hypertrophic 3, chromosome 15 open reading frame 13, CMD1Y, CMH3, HTM-alpha, sarcomeric tropomyosin kappa, TMSA, tropomyosin 1 (alpha), tropomyosin 1 (alpha) isoform 1, tropomyosin 1 (alpha) isoform 2, tropomyosin 1 (alpha) isoform 3, tropomyosin 1 (alpha) isoform 4, tropomyosin 1 (alpha) isoform 5, tropomyosin 1 (alpha) isoform 6, tropomyosin 1 (alpha) isoform 7, tropomyosin alpha-1 chain, Tropomyosin-1 |
|---|
| Gene, Accession # | TPM1, Gene ID: 7168, Accession: Q7Z6L8, SwissProt: Q7Z6L8 |
|---|
| Catalog # | NBP1-52887-20ul |
|---|
| Price | |
|---|
| Order / More Info | Tropomyosin-1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|