| 产品详情 |
| Edit |   |
| Antigenic Specificity | PEX5 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The PEX5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to PEX5. This antibody reacts with human, mouse. The PEX5 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat PEX5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DAVDVTQDYNETDWSQEFISEVTDPLSVSPARWAEEYLEQSEEKLWLGEPEGTATDRWYDEYHPEEDLQHTASDFVAKVDDPKLA |
| Other Names | FLJ50634, FLJ50721, Peroxin-5, peroxisomal biogenesis factor 5, Peroxisomal C-terminal targeting signal import receptor, peroxisomal targeting signal 1 receptor, peroxisomal targeting signal import receptor, peroxisomal targeting signal receptor 1, Peroxisome receptor 1peroxin-5, PTS1 receptor, PTS1-BP, PTS1RFLJ51948, PXR1peroxisomal targeting signal 1 (SKL type) receptor |
| Gene, Accession # | PEX5, Gene ID: 5830 |
| Catalog # | NBP1-87185 |
| Price | |
| Order / More Info | PEX5 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|