| Edit |   |
| Antigenic Specificity | IGFALS/ALS |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The IGFALS/ALS Antibody from Novus Biologicals is a rabbit polyclonal antibody to IGFALS/ALS. This antibody reacts with human. The IGFALS/ALS Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to IGFALS(insulin-like growth factor binding protein, acid labile subunit) The peptide sequence was selected from the middle region of IGFALS. Peptide sequence DCGCPLKALRDFALQNPSAVPRFVQAICEGDDCQPPAYTYNNITCA |
| Other Names | ALS, ALS insulin-like growth factor binding protein complex acid labile chain, insulin-like growth factor binding protein, acid labile subunit, insulin-like growth factor-binding protein complex acid labile subunit |
| Gene, Accession # | IGFALS, Gene ID: 3483, Accession: P35858, SwissProt: P35858 |
| Catalog # | NBP1-59164 |
| Price | |
| Order / More Info | IGFALS/ALS Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |