| 产品详情 |
| Edit |   |
| Antigenic Specificity | IGF2BP1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The IGF2BP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to IGF2BP1. This antibody reacts with human. The IGF2BP1 Antibody has been validated for the following applications: Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human IGF2BP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: HALKVSYIPDEQIAQGPENGRRGGFGSRGQPRQGSPVAAGAPAKQQQVDI |
| Other Names | Coding region determinant-binding protein, CRD-BP, CRDBPIGF-II mRNA-binding protein 1, IGF II mRNA binding protein 1, IMP1, IMP-1ZBP-1, insulin-like growth factor 2 mRNA binding protein 1, insulin-like growth factor 2 mRNA-binding protein 1, VICKZ family member 1, VICKZ1, ZBP1IGF2 mRNA-binding protein 1, Zip code-binding protein 1, Zipcode-binding protein 1 |
| Gene, Accession # | IGF2BP1, Gene ID: 10642, Accession: Q9NZI8, SwissProt: Q9NZI8 |
| Catalog # | NBP2-38956 |
| Price | |
| Order / More Info | IGF2BP1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|