| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | IGFBP-1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The IGFBP-1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to IGFBP-1. This antibody reacts with human. The IGFBP-1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human IGFBP-1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: QQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGS |
|---|
| Other Names | alpha-pregnancy-associated endometrial globulin, amniotic fluid binding protein, binding protein-25, binding protein-26, binding protein-28, growth hormone independent-binding protein, hIGFBP-1, IBP1, IBP-1, IGF-binding protein 1, IGFBP-1, IGF-BP25, insulin-like growth factor binding protein 1, insulin-like growth factor-binding protein 1, Placental protein 12, PP12AFBP |
|---|
| Gene, Accession # | IGFBP1, Gene ID: 3484, Accession: P08833, SwissProt: P08833 |
|---|
| Catalog # | NBP2-33475 |
|---|
| Price | |
|---|
| Order / More Info | IGFBP-1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 24743550 |
|---|
| 产品资料 |
|
|