| Edit |   |
| Antigenic Specificity | CEACAM19 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CEACAM19 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CEACAM19. This antibody reacts with human. The CEACAM19 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to CEACAM19(carcinoembryonic antigen-related cell adhesion molecule 19) The peptide sequence was selected from the middle region of CEACAM19. Peptide sequence MLLRRAQPTDSGTYQVAITINSEWTMKAKTEVQVAEKNKELPSTHLP |
| Other Names | carcinoembryonic antigen-related cell adhesion molecule 19 |
| Gene, Accession # | CEACAM19, Gene ID: 56971 |
| Catalog # | NBP1-70494-20ul |
| Price | |
| Order / More Info | CEACAM19 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |