| Edit |   |
|---|
| Antigenic Specificity | CEACAM19 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CEACAM19 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CEACAM19. This antibody reacts with human. The CEACAM19 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to CEACAM19(carcinoembryonic antigen-related cell adhesion molecule 19) The peptide sequence was selected from the middle region of CEACAM19. Peptide sequence MLLRRAQPTDSGTYQVAITINSEWTMKAKTEVQVAEKNKELPSTHLP |
|---|
| Other Names | carcinoembryonic antigen-related cell adhesion molecule 19 |
|---|
| Gene, Accession # | CEACAM19, Gene ID: 56971 |
|---|
| Catalog # | NBP1-70494 |
|---|
| Price | |
|---|
| Order / More Info | CEACAM19 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|