| 产品详情 |
| Edit |   |
| Antigenic Specificity | RGPD5 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The RGPD5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RGPD5. This antibody reacts with human. The RGPD5 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human RGPD5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: APLTEAAHRHFTIEKHGDSKWIIYRFTKQLCGTERARAKIS |
| Other Names | BS63, BS-63, Epididymis Luminal Protein 161, HEL161, Ran-Binding Protein 2-Like 1, Ran-Binding Protein 2-Like 1/2, ranBP2L1, RANBP2L2, RanBP2-Like 1, RanBP2-Like 1/2, RANBP2-Like And GRIP Domain Containing 5, RANBP2-Like And GRIP Domain-Containing Protein 5, RANBP2-Like And GRIP Domain-Containing Protein 5/6, RGP5, RGP6, RGP7, RGPD7, Sperm Membrane Protein BS-63 |
| Gene, Accession # | RGPD5, Gene ID: 84220, Accession: F8W705 |
| Catalog # | NBP2-46719 |
| Price | |
| Order / More Info | RGPD5 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|