| Edit |   |
| Antigenic Specificity | RGS10 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot, Flow Cytometry, Immunohistochemistry, Immunohistochemistry-Paraffin |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The RGS10 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RGS10. This antibody reacts with human. The RGS10 Antibody has been validated for the following applications: Western Blot, Flow Cytometry, Immunohistochemistry, Immunohistochemistry-Paraffin. |
| Immunogen | Synthetic peptides corresponding to RGS10 (regulator of G-protein signalling 10) The peptide sequence was selected from the middle region of RGS10. Peptide sequence DQIFNLMKYDSYSRFLKSDLFLKHKRTEEEEEDLPDAQTAAKRASRIYNT. |
| Other Names | regulator of G-protein signaling 10, regulator of G-protein signalling 10 |
| Gene, Accession # | RGS10, Gene ID: 6001, Accession: Q96GN0, SwissProt: Q96GN0 |
| Catalog # | NBP1-55396-20ul |
| Price | |
| Order / More Info | RGS10 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |