| 产品详情 |
| Edit |   |
| Antigenic Specificity | RGS16 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The RGS16 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RGS16. This antibody reacts with human. The RGS16 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human RGS16 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MCRTLAAFPTTCLERAKEFKTRLGIFLHKSELGCDTGSTGKFEWGSKHSKENRNFSED |
| Other Names | A28-RGS14, A28-RGS14P, hRGS-r, regulator of G-protein signaling 16, regulator of G-protein signalling 16, Retinally abundant regulator of G-protein signaling, Retinal-specific RGS, RGS-r, RGSR |
| Gene, Accession # | RGS16, Gene ID: 6004 |
| Catalog # | NBP2-49076 |
| Price | |
| Order / More Info | RGS16 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|