| 产品详情 |
| Edit |   |
| Antigenic Specificity | DRP1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The DRP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to DRP1. This antibody reacts with human. The DRP1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human DRP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EADGKVASGGGGVGDGVQEPTTGNWRGMLKTSKAEELLAEEKSKPIPIMPASPQKGHAVNLLDVPVPVARKLSAREQRDCE |
| Other Names | DLP1, DRP1Dnm1p/Vps1p-like protein, DVLPEC 3.6.5.5, Dymple, DYMPLEDYNIV-11, dynamin 1-like, Dynamin family member proline-rich carboxyl-terminal domain less, dynamin-1-like protein, Dynamin-like protein, Dynamin-like protein 4, Dynamin-like protein IV, Dynamin-related protein 1, FLJ41912, HDYNIV, VPS1 |
| Gene, Accession # | DRP1, Gene ID: 10059, Accession: O00429, SwissProt: O00429 |
| Catalog # | NBP2-34205 |
| Price | |
| Order / More Info | DRP1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|