| Edit |   |
|---|
| Antigenic Specificity | FAM122A |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FAM122A Antibody from Novus Biologicals is a rabbit polyclonal antibody to FAM122A. This antibody reacts with human. The FAM122A Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human FAM122A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: AQLSDPGVCVSSDTLDGNSSSAGSSCNSPAKVSTTTDSPVSPAQAASPFIPLDE |
|---|
| Other Names | C9orf42, chromosome 9 open reading frame 42, family with sequence similarity 122A, hypothetical protein LOC116224, MGC17347 |
|---|
| Gene, Accession # | FAM122A, Gene ID: 116224, Accession: Q96E09, SwissProt: Q96E09 |
|---|
| Catalog # | NBP2-31646 |
|---|
| Price | |
|---|
| Order / More Info | FAM122A Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|